PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK20470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 651aa    MW: 74871.6 Da    PI: 7.1253
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK20470.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3672.5e-1122836513373
       GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
                +lL++cA+av+s d++ a+ l +++++++spdg ++qRla+yf+++L+arl+++++ ly+ l ++e s   +++ l  ++l+  ++P+l++s+  aN++I
  PK20470.1 283 TLLTQCAQAVASYDQRTATDLFKQIRQHSSPDGAATQRLAHYFANGLEARLVGTSKVLYSPLVSNEMS---VVDILRGHQLYITACPFLRMSYCFANRTI 379
                69***************************************************999999998888888...***************************** PP

       GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgE 200
                ++ +++++++HiiDf+i++G+QWp L+q L++ p+gpp+lR+Tgv+ p++g   +e++eet++rL++++++++vp e+n+ +ak++e++++e+L+++++E
  PK20470.1 380 MKLAKNAKTIHIIDFGIQYGFQWPGLIQRLSQTPGGPPKLRMTGVELPQPGfrPTERVEETKRRLENYCRRFNVPSEYNM-IAKKWETIHYEDLKINKDE 478
                **************************************************9*****************************.7****************** PP

       GRAS 201 alaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvac 300
                 ++Vn++++l+++lde+v ++++rd+vLkl+++++P ++++   +  +n++ Fl+rf eal +ys+lfd++++++pre++ r+  E+++ gr+i n++ac
  PK20470.1 479 LVVVNCMYRLKHILDETVVINNPRDTVLKLLRKINPALFIHGVYNGTYNAPFFLTRFREALLHYSSLFDMFDSTVPREERYRMEFEKAIYGRDINNIIAC 578
                **************************************************************************************************** PP

       GRAS 301 egaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                eg er+er e++++W+ r  +aGFk+ pl++++ + +k  ++  + + + ve+  ++l++gWk+r+++++S+W
  PK20470.1 579 EGMERVERPESYKQWQVRNARAGFKQTPLDQETFEAVKKKVQLSYHKDFLVEQLGEWLMQGWKGRRIYALSCW 651
                *********************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.509255632IPR005202Transcription factor GRAS
PfamPF035148.8E-110283651IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 651 aa     Download sequence    Send to blast
MDTLLDEFVV SMNGFSYNSP NSIPFYSNQS YVRDAINNDH GGISQPCDYS NELHQHHACE  60
SSQNNSSSCS ELVDSPGYSD SFTATLKFIS EMLMEEEDLE RKSLMLEDPL ALQAAEKSFY  120
DVLGQNYPPS SSDKGDYVVS SKPFSSSVKT SFDHTHLVQG PIFGEPTTSV FFQKGNTQMI  180
DLDKDGVCLQ RGKKNHQGEF GDGNSEEEVR SAKQAAVKGD DFEPTEMLDK VLLNHGENEF  240
AKKLQQQQQQ QQHEVKQQGK RSGRMRRSKK QDKDKTDMVD LWTLLTQCAQ AVASYDQRTA  300
TDLFKQIRQH SSPDGAATQR LAHYFANGLE ARLVGTSKVL YSPLVSNEMS VVDILRGHQL  360
YITACPFLRM SYCFANRTIM KLAKNAKTIH IIDFGIQYGF QWPGLIQRLS QTPGGPPKLR  420
MTGVELPQPG FRPTERVEET KRRLENYCRR FNVPSEYNMI AKKWETIHYE DLKINKDELV  480
VVNCMYRLKH ILDETVVINN PRDTVLKLLR KINPALFIHG VYNGTYNAPF FLTRFREALL  540
HYSSLFDMFD STVPREERYR MEFEKAIYGR DINNIIACEG MERVERPESY KQWQVRNARA  600
GFKQTPLDQE TFEAVKKKVQ LSYHKDFLVE QLGEWLMQGW KGRRIYALSC W
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-442856518374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010106508.10.0hypothetical protein L484_025268
SwissprotQ9XE581e-170SCL14_ARATH; Scarecrow-like protein 14
TrEMBLW9RU650.0W9RU65_9R
STRINGVIT_06s0004g04980.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-167SCARECROW-like 14